Pay in 4 interest-free payments of $62.50 Learn more
Ships within 48 hours · Estimated delivery Jul 26 - Jul 31
which is equivalent to at least 10-30ug of protein per 10ul of the sample to be tested
contributes to host defense through the stimulation of acute phase responses
promote net tissue homeostasis
application dilution species IHC-P 1:100 ICC 1:500 ICFCM 1:50
Frizzled4 plays a crucial role in maintaining the integrity of the blood-brain barrier/blood-eye barrier
PILRα His Tag Protein, Human Size:500μg which is equivalent to atProduct Specification Species Human Synonyms PILR, PILRA, FDF03, AV021745 Accession Q9UKJ1 1 Amino Acid Sequence Gln20 Thr196, with C terminal 8*His QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETGGGSHHHHHHHH Expression System HEK293 Molecular Weight 41 47kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation