Pay in 4 interest-free payments of $25.00 Learn more
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
and activation of immune cells
It is mainly secreted by natural killer (NK) and natural killer T (NKT) cells and plays a role in innate immunity
The expression of HK II is regulated by the Akt/mTOR pathway
with C-terminal Avi & 8*His Tag LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQGGGSGLNDIFEAQKIEWHEHHHHHHHH
In mucosal secretions
MMP2 Recombinant Rabbit mAb (S-1804-55) Size:100μl and activation of immune cellsProduct Specification Host Rabbit Antigen MMP2 Synonyms 72 kDa type IV collagenase; 72 kDa gelatinase; Gelatinase A; Matrix metalloproteinase 2 (MMP 2); TBE 1; CLG4A Immunogen Recombinant Protein Location Cytoplasm, Nucleus, Secreted Accession P08253 Clone Number S 1804 55 Antibody Type Recombinant mAb Isotype IgG Application WB, IHC P Reactivity Hu, Ms Positive Sample U 87 MG, A375, NIH 3T3 Purification Protein A Concentration 0. 5 mg ml Conjugation
US$ 30.00
US$ 40.00
US$ 43.00
US$ 33.00
US$ 27.00
US$ 30.00
US$ 43.00
US$ 33.00